ATE1 (NM_007041) Human Recombinant Protein
CAT#: TP305461
Recombinant protein of human arginyltransferase 1 (ATE1), transcript variant 2
View other "ATE1" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205461 protein sequence
Red=Cloning site Green=Tags(s) MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQT CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDL KTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKE IRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRLVPVSFE DPEFKSSFSQSFSLYVKYQVAIHQDPPDECGKTEFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKI IAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKG QYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQK DPSEEAAVLQYASLVGQKCSERMLLFRN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 58.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_008972 |
Locus ID | 11101 |
UniProt ID | O95260, B3KWA3 |
Cytogenetics | 10q26.13 |
Refseq Size | 4930 |
Refseq ORF | 1554 |
Summary | This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416240 | ATE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424305 | ATE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425062 | ATE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416240 | Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 2 |
USD 396.00 |
|
LY424305 | Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 1 |
USD 605.00 |
|
LY425062 | Transient overexpression lysate of arginyltransferase 1 (ATE1), transcript variant 1 |
USD 396.00 |
|
PH305461 | ATE1 MS Standard C13 and N15-labeled recombinant protein (NP_008972) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review