Epithelial Stromal Interaction 1 (EPSTI1) (NM_001002264) Human Recombinant Protein
CAT#: TP305699
Recombinant protein of human epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 1
View other "EPSTI1" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205699 protein sequence
Red=Cloning site Green=Tags(s) MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLI APNINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREE SVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSA VCGPQSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTE HRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSWGSLLVFSRHLRVYEKILTPIWPSSTDLEKPHEML FLNVILFSLTVFTLISTAHTLDRAVRSDWLLLVLIYACLEELIPELIFNLYCQGNATLFF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002264 |
Locus ID | 94240 |
UniProt ID | Q96J88 |
Cytogenetics | 13q14.11 |
Refseq Size | 3201 |
Refseq ORF | 1230 |
Synonyms | BRESI1 |
Summary | The protein encoded by this gene has been shown to promote tumor invasion and metastasis in some invasive cancer cells when overexpressed. Expression of this gene has been shown to be upregulated by direct binding of the Kruppel like factor 8 protein to promoter sequences. The translated protein interacts with the amino terminal region of the valosin containing protein gene product, resulting in the nuclear translocation of the nuclear factor kappa B subunit 1 gene product, and activation of target genes. Overexpression of this gene has been observed in some breast cancers and in some individuals with systemic lupus erythematosus (SLE). [provided by RefSeq, Sep 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409659 | EPSTI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424196 | EPSTI1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409659 | Transient overexpression lysate of epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 2 |
USD 396.00 |
|
LY424196 | Transient overexpression lysate of epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 1 |
USD 396.00 |
|
PH305699 | EPSTI1 MS Standard C13 and N15-labeled recombinant protein (NP_001002264) |
USD 2,055.00 |
|
PH317229 | EPSTI1 MS Standard C13 and N15-labeled recombinant protein (NP_150280) |
USD 2,055.00 |
|
TP317229 | Recombinant protein of human epithelial stromal interaction 1 (breast) (EPSTI1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review