Nudel (NDEL1) (NM_030808) Human Recombinant Protein

CAT#: TP305974

Recombinant protein of human nudE nuclear distribution gene E homolog (A. nidulans)-like 1 (NDEL1), transcript variant 2

Product Images

Coomassie blue staining of purified NDEL1 protein (Cat# TP305974). The protein was produced from HEK293T cells transfected with NDEL1 cDNA clone (Cat# RC205974) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205974 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQ
  RLKYEVEALKEKLEHQYAQSYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFE
  QRLNQAIERNAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSAV
  QASLSLPATPVGKGTENTFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESKLAACRNFAKDQ
  ASRKSYISGNVNCGVLNGNGTKFSRSGHTSFFDKGAVNGFDTAPPPPGLGSSRPSSAPGMLPLSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_110435
• Locus ID: 81565
• UniProt ID: Q9GZM8
• Cytogenetics: 17p13.1
• Refseq Size: 2407
• Refseq ORF: 1035
• Synonyms: EOPA; MITAP1; NDE1L1; NDE2; NUDEL
• Summary: This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012]