EFCAB1 (NM_024593) Human Recombinant Protein
CAT#: TP306419
Recombinant protein of human EF-hand calcium binding domain 1 (EFCAB1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206419 protein sequence
Red=Cloning site Green=Tags(s) MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMD RVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEE DPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFND M myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_078869 |
Locus ID | 79645 |
UniProt ID | Q9HAE3, A0A024R7U5 |
Cytogenetics | 8q11.21 |
Refseq Size | 2144 |
Refseq ORF | 633 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411209 | EFCAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428290 | EFCAB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411209 | Transient overexpression lysate of EF-hand calcium binding domain 1 (EFCAB1), transcript variant 1 |
USD 396.00 |
|
LY428290 | Transient overexpression lysate of EF-hand calcium binding domain 1 (EFCAB1), transcript variant 2 |
USD 396.00 |
|
PH306419 | EFCAB1 MS Standard C13 and N15-labeled recombinant protein (NP_078869) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review