EFCAB1 (NM_024593) Human Recombinant Protein

CAT#: TP306419

Recombinant protein of human EF-hand calcium binding domain 1 (EFCAB1), transcript variant 1

Product Images

Coomassie blue staining of purified EFCAB1 protein (Cat# TP306419). The protein was produced from HEK293T cells transfected with EFCAB1 cDNA clone (Cat# RC206419) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC206419 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMD
  RVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEE
  DPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFND
  M
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078869
• Locus ID: 79645
• UniProt ID: Q9HAE3, A0A024R7U5
• Cytogenetics: 8q11.21
• Refseq Size: 2144
• Refseq ORF: 633