Pancreatic Polypeptide (PPY) (NM_002722) Human Recombinant Protein
CAT#: TP306584
Purified recombinant protein of Homo sapiens pancreatic polypeptide (PPY)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206584 protein sequence
Red=Cloning site Green=Tags(s) MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHK EDTLAFSEWGSPHAAVPRELSPLDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 7.5 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002713 |
| Locus ID | 5539 |
| UniProt ID | P01298 |
| Cytogenetics | 17q21.31 |
| Refseq Size | 457 |
| Refseq ORF | 285 |
| Synonyms | PNP; PP |
| Summary | This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded 95 aa preproprotein is synthesized in the pancreatic islets of Langerhans and proteolytically processed to generate two peptide products. These products include the active pancreatic hormone of 36 aa and an icosapeptide of unknown function. This hormone acts as a regulator of pancreatic and gastrointestinal functions and may be important in the regulation of food intake. Plasma level of this hormone has been shown to be reduced in conditions associated with increased food intake and elevated in anorexia nervosa. In addition, infusion of this hormone in obese rodents has shown to decrease weight gain. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| PH306584 | PPY MS Standard C13 and N15-labeled recombinant protein (NP_002713) |
USD 2,055.00 |
|
| TP721220 | Purified recombinant protein of Human pancreatic polypeptide (PPY) |
USD 330.00 |
|
| TP762154 | Purified recombinant protein of Human pancreatic polypeptide (PPY),Ala30-Arg88, N-terminal His-PDCD1(Pro21-Val170) tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China