LYNX1-SLURP2 (NM_023946) Human Recombinant Protein

CAT#: TP307126

Recombinant protein of human Ly6/neurotoxin 1 (LYNX1), transcript variant 1

Product Images

Coomassie blue staining of purified LYNX1-SLURP2 protein (Cat# TP307126). The protein was produced from HEK293T cells transfected with LYNX1-SLURP2 cDNA clone (Cat# RC207126) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207126 representing NM_023946
  Red=Cloning site Green=Tags(s)
  
  MTPLLTLILVVLMGLPLAQALDCHVCAYNGDNCFNPMRCPAMVAYCMTTRTSAAEAIWCHQCTGFGGCSH
  GSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_076435
• Locus ID: 111188157
• UniProt ID: P0DP58
• Cytogenetics: 8q24.3
• Refseq Size: 1352
• Refseq ORF: 393
• Summary: This locus represents naturally occurring read-through transcription between the neighboring LYNX1 and SLURP2 genes. The readthrough transcript encodes a fusion protein comprised of sequence sharing identity with each individual gene product. The significance of this read-through transcription and the function of the resulting protein product have not yet been determined. [provided by RefSeq, Sep 2017]