Mimitin (NDUFAF2) (NM_174889) Human Recombinant Protein

CAT#: TP307387

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2 (NDUFAF2), nuclear gene encoding mitochondrial protein

Product Images

Coomassie blue staining of purified NDUFAF2 protein (Cat# TP307387). The protein was produced from HEK293T cells transfected with NDUFAF2 cDNA clone (Cat# RC207387) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207387 representing NM_174889
  Red=Cloning site Green=Tags(s)
  
  MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTE
  WEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGK
  EEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_777549
• Locus ID: 91942
• UniProt ID: Q8N183, A0A0S2Z5U1
• Cytogenetics: 5q12.1
• Refseq Size: 650
• Refseq ORF: 507
• Synonyms: B17.2L; MC1DN10; mimitin; MMTN; NDUFA12L
• Summary: NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency. [provided by RefSeq, Jul 2008]