SNX16 (NM_152836) Human Recombinant Protein
CAT#: TP307476
Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 2
View other "SNX16" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207476 protein sequence
Red=Cloning site Green=Tags(s) MATPYVPVPMPIGNSASSFTTNRNQRSSSFGSVSTSSNSSKGQLEDSNMGNFKQTSVPDQMDNTSSVCSS PLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWEDRPSTPTILGYEVMEERAKFTVYKILVKKTPEESWV VFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREF LCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESLKKLLSEKQLHIDTLENRIRTLSLEPE ESLDVSETEGEQILKVESSALEVDQDVLDEESRADNKPCLSFSEPENAVSEIEVAEVAYDAEED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_690049 |
Locus ID | 64089 |
UniProt ID | P57768 |
Cytogenetics | 8q21.13 |
Refseq Size | 3225 |
Refseq ORF | 1032 |
Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. The protein encoded by this gene associates with late endosome membranes as is involved in tubule formation, cholesterol transport, and transport of tetraspanin CD81. The encoded protein also inhibits cell migration and tumorigenesis. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403494 | SNX16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC411753 | SNX16 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403494 | Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 2 |
USD 396.00 |
|
LY411753 | Transient overexpression lysate of sorting nexin 16 (SNX16), transcript variant 1 |
USD 396.00 |
|
PH307476 | SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_690049) |
USD 2,055.00 |
|
PH316565 | SNX16 MS Standard C13 and N15-labeled recombinant protein (NP_071416) |
USD 2,055.00 |
|
TP316565 | Recombinant protein of human sorting nexin 16 (SNX16), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review