FKBP6 (NM_003602) Human Recombinant Protein
CAT#: TP307712
Recombinant protein of human FK506 binding protein 6, 36kDa (FKBP6), transcript variant 1
View other "FKBP6" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207712 protein sequence
Red=Cloning site Green=Tags(s) MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDR PFDSNYFRKTPRLMKLGEDITLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELL DFLDCAESDKFCALSAEQQDQFPLQKVLKVAATEREFGNYLFRQNRFYDAKVRYKRALLLLRRRSAPPEE QHLVEAAKLPVLLNLSFTYLKLDRPTIALCYGEQALIIDQKNAKALFRCGQACLLLTEYQKARDFLVRAQ KEQPFNHDINNELKKLASCYRDYVDKEKEMWHRMFAPCGDGSTAGES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003593 |
Locus ID | 8468 |
UniProt ID | O75344 |
Cytogenetics | 7q11.23 |
Refseq Size | 1640 |
Refseq ORF | 981 |
Synonyms | FKBP36 |
Summary | The protein encoded by this gene is a cis-trans peptidyl-prolyl isomerase that may function in immunoregulation and basic cellular processes involving protein folding and trafficking. This gene is located in a chromosomal region that is deleted in Williams-Beuren syndrome. Defects in this gene may cause male infertility. There are multiple pseudogenes for this gene located nearby on chromosome 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418553 | FKBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427592 | FKBP6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418553 | Transient overexpression lysate of FK506 binding protein 6, 36kDa (FKBP6), transcript variant 1 |
USD 396.00 |
|
LY427592 | Transient overexpression lysate of FK506 binding protein 6, 36kDa (FKBP6), transcript variant 2 |
USD 396.00 |
|
PH307712 | FKBP6 MS Standard C13 and N15-labeled recombinant protein (NP_003593) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review