Calcipressin 3 (RCAN3) (NM_013441) Human Recombinant Protein

CAT#: TP307755

Recombinant protein of human RCAN family member 3 (RCAN3)

Product Images

Coomassie blue staining of purified RCAN3 protein (Cat# TP307755). The protein was produced from HEK293T cells transfected with RCAN3 cDNA clone (Cat# RC207755) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207755 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEA
  LFTIYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQ
  PVKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEE
  TKNPKQKIAQTRRPDPPTAALNEPQTFDCAL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038469
• Locus ID: 11123
• UniProt ID: Q9UKA8, A0A024RAH2
• Cytogenetics: 1p36.11
• Refseq Size: 2787
• Refseq ORF: 723
• Synonyms: DSCR1L2; hRCN3; MCIP3; RCN3
• Summary: Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development (By similarity).[UniProtKB/Swiss-Prot Function]