Nurim (NRM) (NM_007243) Human Recombinant Protein

CAT#: TP308090

Recombinant protein of human nurim (nuclear envelope membrane protein) (NRM)

Product Images

Coomassie blue staining of purified NRM protein (Cat# TP308090). The protein was produced from HEK293T cells transfected with NRM cDNA clone (Cat# RC208090) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208090 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL
  LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL
  CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV
  PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_009174
• Locus ID: 11270
• UniProt ID: Q8IXM6, A0A1U9X845, B3KQU6
• Cytogenetics: 6p21.33
• Refseq Size: 1767
• Refseq ORF: 786
• Synonyms: NRM29
• Summary: The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
• Protein Families: Transmembrane