CCDC78 (NM_001031737) Human Recombinant Protein
CAT#: TP308165
Recombinant protein of human coiled-coil domain containing 78 (CCDC78)
View other "CCDC78" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208165 protein sequence
Red=Cloning site Green=Tags(s) MEHAATTGPRPGPPSRRVENVVLRAKDWLPGAPGGTAVWATSLEAEVPPDLALNKEQQLQISKELVDIQI TTHHLHEQHEAEIFQLKSEILRLESRVLELELRGDGTSQGCAVPVESDPRHPRAAAQELRHKAQVPGHSD DHRFQVQPKNTMNPENEQHRLGSGLQGEVKWALEHQEARQQALVTRVATLGRQLQGAREEARAAGQRLAT QAVVLCSCQGQLRQAEAENARLQLQLKKLKDEYVLRLQHCARQAVEHADGAGQAPATTALRTFLEATLED IRAAHRSREQQLARAARSYHKRLVDLSRRHEELLVAYRAPGNPQAIFDIASLDLEPLPVPLVTDFSHRED QHGGPGALLSSPKKRPGGASQGGTSEPQGLDAASWAQIHQKLRDFSRSTQSWNGSGHSCWSGPRWLKSNF LSYRSTWTSTWAGTSTKS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 48.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001026907 |
Locus ID | 124093 |
UniProt ID | A2IDD5 |
Cytogenetics | 16p13.3 |
Refseq Size | 1611 |
Refseq ORF | 1314 |
Synonyms | C16orf25; CNM4; hsCCDC78; JFP10 |
Summary | The product of this gene contains two coiled-coil domains. The function of this gene is currently unknown. [provided by RefSeq, Sep 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406609 | CCDC78 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC422182 | CCDC78 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430403 | CCDC78 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406609 | Transient overexpression lysate of coiled-coil domain containing 78 (CCDC78), transcript variant 2 |
USD 396.00 |
|
LY422182 | Transient overexpression lysate of coiled-coil domain containing 78 (CCDC78) |
USD 396.00 |
|
LY430403 | Transient overexpression lysate of coiled-coil domain containing 78 (CCDC78), transcript variant 2 |
USD 396.00 |
|
PH308165 | CCDC78 MS Standard C13 and N15-labeled recombinant protein (NP_001026907) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review