ZFP91 (NM_053023) Human Recombinant Protein
CAT#: TP308217
Recombinant protein of human zinc finger protein 91 homolog (mouse) (ZFP91)
View other "ZFP91" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208217 protein sequence
Red=Cloning site Green=Tags(s) MPGETEEPRPPEQQDQEGGEAAKAAPEEPQQRPPEAIAAAPAGTTSSRVLRGGRDRGRAAAAAAAAAVSR RRKAEYPRRRRSSPSARPPDVPGQQPQAAKSPSPVQGKKSPRLLCIEKVTTDKDPKEEKEEEDDSALPQE VSIAASRPSRGWRSSRTSVSRHRDTENTRSSRSKTGSLQLICKSEPNTDQLDYDVGEEHQSPGGISEEEE EEEEEMLISEEEIPFKDDPRDETYKPHLERETPKPRRKSGKVKEEKEKKEIKVEVEVEVKEEENEIREDE EPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGR LFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKK HDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIAEALAANAGALITSTDILGTNPESLTQPSDGQG LPLLPEPLGNSTSGECLLLEAEGMSKSYCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVL IEDSDSAGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_444251 |
Locus ID | 80829 |
UniProt ID | Q96JP5, A0A024R4Z1 |
Cytogenetics | 11q12.1 |
Refseq Size | 5735 |
Refseq ORF | 1152 |
Synonyms | DMS-8; DSM-8; DSM8; FKSG11; PZF; ZFP-91; ZNF757 |
Summary | The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in lymphotoxin-beta receptor signaling. Alternative splicing results in multiple transcript variants. A read-through transcript variant composed of ZFP91 and the downstream CNTF gene sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A ZFP91-related pseudogene has also been identified on chromosome 2. [provided by RefSeq, Oct 2010] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409325 | ZFP91 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409325 | Transient overexpression lysate of zinc finger protein 91 homolog (mouse) (ZFP91) |
USD 396.00 |
|
PH308217 | ZFP91 MS Standard C13 and N15-labeled recombinant protein (NP_444251) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review