beta Defensin 1 (DEFB1) (NM_005218) Human Recombinant Protein
CAT#: TP308244
Recombinant protein of human defensin, beta 1 (DEFB1)
View other "DEFB1" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208244 protein sequence
Red=Cloning site Green=Tags(s) MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005209 |
Locus ID | 1672 |
UniProt ID | P60022 |
Cytogenetics | 8p23.1 |
Refseq Size | 484 |
Refseq ORF | 204 |
Synonyms | BD1; DEFB-1; DEFB101; HBD1 |
Summary | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401597 | DEFB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401597 | Transient overexpression lysate of defensin, beta 1 (DEFB1) |
USD 396.00 |
|
PH308244 | DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209) |
USD 2,055.00 |
|
TP720106 | Recombinant protein of human defensin, beta 1 (DEFB1) |
USD 330.00 |
|
TP723030 | Purified recombinant protein of Human defensin, beta 1 (DEFB1). |
USD 240.00 |
|
TP723031 | Purified recombinant protein of Human defensin, beta 1 (DEFB1). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review