COA5 (NM_001008215) Human Recombinant Protein
CAT#: TP308299
Recombinant protein of human chromosome 2 open reading frame 64 (C2orf64)
View other "COA5" proteins (1)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208299 protein sequence
Red=Cloning site Green=Tags(s) MPKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFRG RKGY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008216 |
Locus ID | 493753 |
UniProt ID | Q86WW8 |
Cytogenetics | 2q11.2 |
Refseq Size | 1767 |
Refseq ORF | 222 |
Synonyms | 6330578E17Rik; C2orf64; CEMCOX3; MC4DN9; Pet191 |
Summary | This gene encodes an ortholog of yeast Pet191, which in yeast is a subunit of a large oligomeric complex associated with the mitochondrial inner membrane, and required for the assembly of the cytochrome c oxidase complex. Mutations in this gene are associated with mitochondrial complex IV deficiency, a disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to a severe disease affecting several tissues and organs. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH308299 | C2orf64 MS Standard C13 and N15-labeled recombinant protein (NP_001008216) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review