Methionine Sulfoxide Reductase A (MSRA) (NM_012331) Human Recombinant Protein

CAT#: TP308916

Recombinant protein of human methionine sulfoxide reductase A (MSRA), transcript variant 1

Product Images

Coomassie blue staining of purified MSRA protein (Cat# TP308916). The protein was produced from HEK293T cells transfected with MSRA cDNA clone (Cat# RC208916) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208916 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVF
  GMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWEN
  HDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQ
  YLSKNPNGYCGLGGTGVSCPVGIKK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036463
• Locus ID: 4482
• UniProt ID: Q9UJ68
• Cytogenetics: 8p23.1
• Refseq Size: 1543
• Refseq ORF: 705
• Synonyms: PMSR
• Summary: This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]