Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Recombinant Protein

CAT#: TP308964

Recombinant protein of human Shwachman-Bodian-Diamond syndrome (SBDS)

Product Images

Coomassie blue staining of purified SBDS protein (Cat# TP308964). The protein was produced from HEK293T cells transfected with SBDS cDNA clone (Cat# RC208964) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208964 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKED
  LISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDI
  HYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVC
  LIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057122
• Locus ID: 51119
• UniProt ID: Q9Y3A5, A0A0S2Z5I7
• Cytogenetics: 7q11.21
• Refseq Size: 1605
• Refseq ORF: 750
• Synonyms: CGI-97; SDO1; SDS; SWDS
• Summary: This gene encodes a highly conserved protein that plays an essential role in ribosome biogenesis. The encoded protein interacts with elongation factor-like GTPase 1 to disassociate eukaryotic initiation factor 6 from the late cytoplasmic pre-60S ribosomal subunit allowing assembly of the 80S subunit. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017]