SCOC (NM_032547) Human Recombinant Protein

CAT#: TP309356

Recombinant protein of human short coiled-coil protein (SCOC)

Product Images

Coomassie blue staining of purified SCOC protein (Cat# TP309356). The protein was produced from HEK293T cells transfected with SCOC cDNA clone (Cat# RC209356) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209356 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDGSRKEEEEDSTFTNISLADDIDHSSRILYPRPKSLLPKMMNADMDVDAENQVELEEKTRLINQVLELQ
  HTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_115936
• Locus ID: 60592
• UniProt ID: Q9UIL1
• Cytogenetics: 4q31.1
• Refseq Size: 1974
• Refseq ORF: 999
• Synonyms: HRIHFB2072; SCOCO; UNC-69
• Summary: This gene encodes a short coiled-coiled domain-containing protein that localizes to the Golgi apparatus. The encoded protein interacts with ADP-ribosylation factor-like proteins. Pseudogenes of this gene are found on chromosomes 1 and 14. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]