ARL8B (NM_018184) Human Recombinant Protein

CAT#: TP309368

Recombinant protein of human ADP-ribosylation factor-like 8B (ARL8B)

Product Images

Coomassie blue staining of purified ARL8B protein (Cat# TP309368). The protein was produced from HEK293T cells transfected with ARL8B cDNA clone (Cat# RC209368) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209368 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIW
  DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDE
  KQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060654
• Locus ID: 55207
• UniProt ID: Q9NVJ2
• Cytogenetics: 3p26.1
• Refseq Size: 3008
• Refseq ORF: 558
• Synonyms: ARL10C; Gie1
• Summary: Plays a role in lysosome motility (PubMed:16537643, PubMed:25898167). In neurons, mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles required for presynaptic biogenesis and synaptic function (By similarity). May play a role in chromosome segregation (PubMed:15331635).[UniProtKB/Swiss-Prot Function]