OBP2A (NM_014582) Human Recombinant Protein

CAT#: TP310114

Recombinant protein of human odorant binding protein 2A (OBP2A)

Product Images

Coomassie blue staining of purified OBP2A protein (Cat# TP310114). The protein was produced from HEK293T cells transfected with OBP2A cDNA clone (Cat# RC210114) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210114 representing NM_014582
  Red=Cloning site Green=Tags(s)
  
  MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMR
  EDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEAL
  EEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 17.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055397
• Locus ID: 29991
• UniProt ID: Q9NY56
• Cytogenetics: 9q34.3
• Refseq Size: 689
• Refseq ORF: 510
• Synonyms: hOBPIIa; LCN13; OBP; OBP2C; OBPIIa
• Summary: This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein