STK19 (NM_004197) Human Recombinant Protein
CAT#: TP318770
Purified recombinant protein of Homo sapiens serine/threonine kinase 19 (STK19), transcript variant 1
View other "STK19" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218770 representing NM_004197
Red=Cloning site Green=Tags(s) MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGG GDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLR GEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAH GIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQMTQTFGFRDSEITHLVNAGVLTVRD AGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDC ISTTSGTLLRLPET myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004188 |
Locus ID | 8859 |
UniProt ID | P49842, A0A1U9X8L3 |
Cytogenetics | 6p21.33 |
Refseq Size | 1620 |
Refseq ORF | 1092 |
Synonyms | D6S60; D6S60E; G11; HLA-RP1; RP1 |
Summary | This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410091 | STK19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418155 | STK19 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410091 | Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 2 |
USD 396.00 |
|
LY418155 | Transient overexpression lysate of serine/threonine kinase 19 (STK19), transcript variant 1 |
USD 396.00 |
|
PH318770 | STK19 MS Standard C13 and N15-labeled recombinant protein (NP_004188) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review