NAPE PLD (NAPEPLD) (NM_001122838) Human Recombinant Protein

CAT#: TP325603

Recombinant protein of human N-acyl phosphatidylethanolamine phospholipase D (NAPEPLD), transcript variant 1

Product Images

Coomassie blue staining of purified NAPEPLD protein (Cat# TP325603). The protein was produced from HEK293T cells transfected with NAPEPLD cDNA clone (Cat# RC225603) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225603 representing NM_001122838
  Red=Cloning site Green=Tags(s)
  
  MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP
  TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD
  ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF
  VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF
  FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA
  NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001116310
• Locus ID: 222236
• UniProt ID: Q6IQ20
• Cytogenetics: 7q22.1
• Refseq ORF: 1179
• Synonyms: C7orf18; FMP30; NAPE-PLD
• Summary: NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by OMIM, Oct 2008]