MBNL3 (NM_001170702) Human Recombinant Protein

CAT#: TP329842

Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4.

Product Images

Coomassie blue staining of purified MBNL3 protein (Cat# TP329842). The protein was produced from HEK293T cells transfected with MBNL3 cDNA clone (Cat# RC229842) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC229842 representing NM_001170702
  Red=Cloning site Green=Tags(s)
  
  MERASKNLKGRCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMT
  PSIPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTR
  GENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQ
  PGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLPQPAFIPAVPMMHGATPTTVSAATTPATSVP
  FAAPTTGNQLKF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.2
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001164173
• Locus ID: 55796
• UniProt ID: Q9NUK0
• Cytogenetics: Xq26.2
• Refseq ORF: 876
• Synonyms: CHCR; MBLX; MBLX39; MBXL
• Summary: This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009]