SARS-CoV-2 Spike-RBD Protein (MN908947) SARS-CoV-2 Recombinant Protein

CAT#: TP701142

Purified recombinant SARS coronavirus 2 Spike-RBD protein(Lys310~Leu560), with C-terminal Human FC tag,secretory expressed in HEK293 cells, 50ug


USD 788.00

5 Days*

Size
    • 50 ug

Product Images

Other products for "SARS-CoV-2 Spike-RBD Protein"

Specifications

Product Data
Species SARS-CoV-2
Expression Host HEK293
Expression cDNA Clone or AA Sequence
MALWIDRMQLLSCIALSLALVTNSAKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLGGGSGGGSPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Tag C-Fc Human
Predicted MW 56.1 KDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 95% as determined by SDS-PAGE and Coomassie blue staining
Buffer PBS,10% Glycerol
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq QHD43416

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.