SARS-CoV-2 Spike-RBD Protein (MN908947) SARS-CoV-2 Recombinant Protein
CAT#: TP701142
Purified recombinant SARS coronavirus 2 Spike-RBD protein(Lys310~Leu560), with C-terminal Human FC tag,secretory expressed in HEK293 cells, 50ug
Other products for "SARS-CoV-2 Spike-RBD Protein"
Specifications
Product Data | |
Species | SARS-CoV-2 |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
MALWIDRMQLLSCIALSLALVTNSAKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLGGGSGGGSPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
|
Tag | C-Fc Human |
Predicted MW | 56.1 KDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | PBS,10% Glycerol |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | QHD43416 |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.