Cx3cl1 (NM_134455) Rat Recombinant Protein
CAT#: TP723117
Purified recombinant protein of Rat chemokine (C-X3-C motif) ligand 1 (Cx3cl1).
Product Images
Other products for "Cx3cl1"
Specifications
Product Data | |
Species | Rat |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKRAIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTRNG
|
Tag | Tag Free |
Predicted MW | 8.7 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract human monocytes using a concentration range of 5.0-10.0 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_604450 |
Locus ID | 89808 |
UniProt ID | O55145 |
Cytogenetics | 19p13 |
Refseq Size | 3044 |
Refseq ORF | 1179 |
Synonyms | Cx3c; Scyd1 |
Summary | chemokine that binds its receptor CX3CR1; induces chemotaxis and increased intracellular calcium levels in microglia [RGD, Feb 2006] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.