Il1a (NM_017019) Rat Recombinant Protein

CAT#: TP723208

Purified recombinant protein of Rat interleukin 1 alpha (Il1a).

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MAPHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS
• Tag: Tag Free
• Predicted MW: 17.7 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bioactivity: The ED50 as determined by the dose-dependent proliferation of murine D10S cells is > 0.005 ng/ml, corresponding to a specific activity of > 2 x 10^8 units/mg.
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_058715
• Locus ID: 24493
• UniProt ID: P16598
• Cytogenetics: 3q36
• Refseq Size: 1992
• Refseq ORF: 810
• Synonyms: IL-1 alpha; IL-1F1
• Summary: proinflammatory cytokine [RGD, Feb 2006]