Retnla (NM_020509) Mouse Recombinant Protein

CAT#: TP723378

Purified recombinant protein of Mouse resistin like alpha (cDNA clone MGC:35890 IMAGE:4189285).

Product Images

Specifications

Product Data

• Species: Mouse
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
• Tag: Tag Free
• Predicted MW: 10 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065255
• Locus ID: 57262
• UniProt ID: Q9EP95, Q8JZM3, G3X8W2
• Cytogenetics: 16 30.75 cM
• Refseq Size: 554
• Refseq ORF: 333
• Synonyms: 1810019L16Rik; Fizz-1; Fizz1; HIMF; RELM-alpha; RELMa; RELMalpha; Xcp2