Antibodies for $/€ 289

Jump to Filters
View as table Download
CSHL1 Rabbit Polyclonal Antibody
TA346286

USD 475.00

5 Days

Rabbit Polyclonal Anti-CSHL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSHL1 antibody: synthetic peptide directed towards the C terminal of human CSHL1. Synthetic peptide located within the following region: GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV