Rabbit Polyclonal Anti-HOXC9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXC9 antibody: synthetic peptide directed towards the N terminal of human HOXC9. Synthetic peptide located within the following region: MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDF |
Rabbit Polyclonal Anti-Hoxc9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hoxc9 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hoxc9. Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ |
Germany
Japan
United Kingdom
China