Primary Antibodies

View as table Download

Rabbit Polyclonal anti-TCEB2 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TCEB2 antibody: synthetic peptide directed towards the middle region of human TCEB2. Synthetic peptide located within the following region: TARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQ

ELOB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ELOB