KLHL25 chicken polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | 14 amino acid peptide near the center of Human ENC-2. |
KLHL25 chicken polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | 14 amino acid peptide near the center of Human ENC-2. |
Rabbit Polyclonal Anti-KLHL25 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLHL25 antibody: synthetic peptide directed towards the N terminal of human KLHL25. Synthetic peptide located within the following region: RLYEFSWRMCLVHFETVRQSEDFNSLSKDTLLDLISSDELETEDERVVFE |