GGA3 (702-713) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bat, Equine, Human, Monkey, Porcine, Rabbit |
Immunogen | Synthetic peptide from (C-term) of human GGA3 |
GGA3 (702-713) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bat, Equine, Human, Monkey, Porcine, Rabbit |
Immunogen | Synthetic peptide from (C-term) of human GGA3 |
Rabbit Polyclonal Anti-GGA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GGA3 Antibody: synthetic peptide directed towards the N terminal of human GGA3. Synthetic peptide located within the following region: AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL |
Rabbit polyclonal anti-GGA3 antibody
Applications | WB |
Reactivities | Chimpanzee, Human |
Conjugation | Unconjugated |
Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 400-415 of Human GGA3. |