Rabbit polyclonal anti-RPS13 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS13. |
Rabbit polyclonal anti-RPS13 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPS13. |
Rabbit Polyclonal Anti-RPS13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS13 Antibody: synthetic peptide directed towards the N terminal of human RPS13. Synthetic peptide located within the following region: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQI |
Rabbit Polyclonal Anti-RPS13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS13 Antibody: synthetic peptide directed towards the middle region of human RPS13. Synthetic peptide located within the following region: ILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIES |