Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GSTM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSTM3 Antibody: synthetic peptide directed towards the middle region of human GSTM3. Synthetic peptide located within the following region: EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF

Rabbit Polyclonal Anti-GSTM3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSTM3 Antibody: synthetic peptide directed towards the middle region of human GSTM3. Synthetic peptide located within the following region: SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF

GSTM3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-225 of human GSTM3 (NP_000840.2).
Modifications Unmodified

GSTM3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 101-225 of human GSTM3 (NP_000840.2).
Modifications Unmodified