Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHGDH

PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

PHGDH mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

PHGDH mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

PHGDH mouse monoclonal antibody, clone OTI9C2 (formerly 9C2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated