Rabbit Polyclonal Anti-PDGFA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFA Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-PDGFA Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFA Antibody: A synthesized peptide |
Anti-Human PDGF-AA Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PDGF-AA |
Biotinylated Anti-Human PDGF-AA Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human PDGF-AA |
Rabbit Polyclonal Anti-PDGFA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDGFA antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFA. Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR |
Anti-PDGFA Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide |
Anti-PDGFA Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 101-114 amino acids of Human platelet-derived growth factor alpha polypeptide |