Rabbit anti-GRIK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIK2 |
Rabbit anti-GRIK2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRIK2 |
Rabbit Polyclonal Anti-GRIK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the N terminal of human GRIK2. Synthetic peptide located within the following region: LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP |
Rabbit Polyclonal Grik2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Grik2 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Grik2. |
Rabbit Polyclonal Anti-GRIK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the C terminal of human GRIK2. Synthetic peptide located within the following region: TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST |
Rabbit anti GluR6/7 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |