Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-OAT Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI

Goat Polyclonal Anti-creatine kinase M-type (aa258-270) Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-creatine kinase M-type (aa258-270) Antibody: Peptide with sequence C-QKIEEIFKKAGHP, from the internal region of the protein sequence according to NP_001815.2.

Rabbit polyclonal GOT2 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2.

Goat Anti-Arginase I Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2.

Rabbit polyclonal antibody to Aminoacylase-1 (aminoacylase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 366 of Aminoacylase 1 (Uniprot ID#Q03154)

Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277)

Rabbit polyclonal OTC Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This OTC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the Central region of human OTC.

Rabbit Polyclonal Anti-CPS1 Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI

Goat Polyclonal Antibody against CKB / Brain Creatine Kinase

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KPSDEHKTDLNPDN, from the internal region of the protein sequence according to NP_001814.2.

Goat Polyclonal Antibody against MAOB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3.

GOT2 Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region (QGYRYYDPKTCGFD)