Primary Antibodies

Jump to Filters
View as table Download
EHD1 (2-15) Goat Polyclonal Antibody
AP23976PU-N

USD 440.00

2 Weeks

EHD1 (2-15) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Bovine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from positions 2-15 of human EHD1 (NP_006786.2)
EHD1 Rabbit Polyclonal Antibody
TA340138

USD 375.00

5 Days

Rabbit Polyclonal Anti-EHD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EHD1 antibody: synthetic peptide directed towards the middle region of human EHD1. Synthetic peptide located within the following region: AKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHE