Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ApoA4 Antibody

Applications WB
Reactivities Chicken, Human
Conjugation Unconjugated
Immunogen ApoA4 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of chicken ApoA4.

Goat Polyclonal Antibody against APOA4

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-KEKESQDKTLSLP, from the internal region (near the C Terminus) of the protein sequence according to NP_000473.2.

Rabbit Polyclonal ApoA4 Antibody

Applications WB
Reactivities Human
Immunogen ApoA4 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ApoA4.

Rabbit Polyclonal Anti-APOA4 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-APOA4 Antibody: synthetic peptide directed towards the C terminal of human APOA4. Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ

Rabbit Polyclonal Anti-APOA4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human APOA4

APOA4 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse APOA4

APOA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 227-396 of human APOA4 (NP_000473.2).
Modifications Unmodified

ApoA4 Mouse monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated