Primary Antibodies

View as table Download

Rabbit anti-AREG Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AREG

Rabbit Polyclonal Anti-AREG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AREG

Rabbit Polyclonal anti-AREG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AREG antibody: synthetic peptide directed towards the middle region of human AREG. Synthetic peptide located within the following region: PQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR

AREG Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-252 of human AREG (NP_001648.1).
Modifications Unmodified

Amphiregulin Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Produced from sera of rabbits immunized with highly pure Recombinant Human Amphiregulin. Anti-Human Amphiregulin-specific antibody was purified by affinity chromatography employing an immobilized Human Amphiregulin matrix.

Amphiregulin Antibody (biotin)

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Produced from sera of rabbits immunized with highly pure Recombinant Human Amphiregulin. Anti-Human Amphiregulin-specific antibody was purified by affinity chromatography and then biotinylated.