Rabbit Polyclonal Anti-CRYZL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRYZL1 antibody is: synthetic peptide directed towards the C-terminal region of Human CRYZL1. Synthetic peptide located within the following region: LLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGATLAFLNDEVW |
Carrier-free (BSA/glycerol-free) CRYZL1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
CRYZL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
CRYZL1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
CRYZL1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
CRYZL1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
CRYZL1 mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
