Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV

Carrier-free (BSA/glycerol-free) CYP2C9 mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CYP2C9 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2C9

CYP2C9 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CYP2C9

CYP2C9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-490 of human CYP2C9 (NP_000762.2).
Modifications Unmodified

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI3D2 (formerly 3D2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

CYP2C9 (Cytochrome P450 2C9) mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP