Primary Antibodies

View as table Download

Rabbit anti-EPB41 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human EPB41

Rabbit Polyclonal Anti-EPB41 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the middle region of human EPB41. Synthetic peptide located within the following region: QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK

Rabbit polyclonal EPB41 (Tyr660/418) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EPB41 around the phosphorylation site of tyrosine 660/418 (N-I-YP-I-R).
Modifications Phospho-specific

Rabbit Polyclonal anti-EPB41 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the N terminal of human EPB41. Synthetic peptide located within the following region: SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD

Rabbit Polyclonal anti-EPB41 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the N terminal of human EPB41. Synthetic peptide located within the following region: EKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQ

EPB41 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-500 of human EPB41 (NP_001159478.1).
Modifications Unmodified