Rabbit anti-EPB41 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EPB41 |
Rabbit anti-EPB41 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EPB41 |
Rabbit Polyclonal Anti-EPB41 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the middle region of human EPB41. Synthetic peptide located within the following region: QVAEGGVLDASAKKTVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKKK |
Rabbit polyclonal EPB41 (Tyr660/418) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EPB41 around the phosphorylation site of tyrosine 660/418 (N-I-YP-I-R). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-EPB41 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the N terminal of human EPB41. Synthetic peptide located within the following region: SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD |
Rabbit Polyclonal anti-EPB41 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPB41 antibody: synthetic peptide directed towards the N terminal of human EPB41. Synthetic peptide located within the following region: EKGEGGQKEIEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQ |
EPB41 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 210-500 of human EPB41 (NP_001159478.1). |
Modifications | Unmodified |