Primary Antibodies

View as table Download

Rabbit polyclonal antibody to EPS8 (epidermal growth factor receptor pathway substrate 8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 761 and 822 of EPS8 (Uniprot ID#Q12929)

Mouse Monoclonal Eps8 Antibody (18F1F2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Eps8 Antibody (18F5B11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Goat Anti-EPS8 Antibody

Applications IHC
Reactivities Expected from seq similarity: Human, Mouse, Rat, Dog, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-SGVESFDEGSSH, from the C Terminus of the protein sequence according to NP_004438.3.

Rabbit Polyclonal Anti-EPS8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPS8 antibody: synthetic peptide directed towards the middle region of human EPS8. Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH

Rabbit Polyclonal Anti-Eps8 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Eps8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eps8. Synthetic peptide located within the following region: VFNQITVQKAALEDSNGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH

EPS8 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human EPS8 (NP_004438.3).
Modifications Unmodified