Primary Antibodies

View as table Download

GABRA3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA3

Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus.

Rabbit Polyclonal Anti-GABRA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

GABA A Receptor alpha 3 (GABRA3) (480-492) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bat, Bovine, Equine, Hamster, Human, Monkey, Mouse, Rabbit, Rat
Immunogen Synthetic peptide from C-Terminus of human GABRA3 (NP_000799.1)

Rabbit Anti-GABAA Receptor a 3 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the N-terminal region of the alpha 3 subunit

Anti-Gabra3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa. 33~37(R-R-Q-E-P)derived from Rat GABA A Receptor a3.

Rabbit Polyclonal Anti-GABRA3 Antibody

Applications IHC
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the N terminal of human GABRA3. Synthetic peptide located within the following region: GTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRL

Rabbit Polyclonal Anti-Gabra3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gabra3 antibody is: synthetic peptide directed towards the N-terminal region of Rat Gabra3. Synthetic peptide located within the following region: LLISILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIF

GABRA3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRA3

GABRA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-276 of human GABRA3 (NP_000799.1).
Modifications Unmodified

GABRA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-276 of human GABRA3 (NP_000799.1).
Modifications Unmodified