Primary Antibodies

View as table Download

GABA A Receptor beta 3 (GABRB3) (400-411) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Canine, Equine, Hamster, Human, Monkey, Mouse, Rat
Immunogen Synthetic peptide from an internal region of human GABRB3 (NP_000805.1; NP_068712.1)

GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence C-EKTAKAKNDRSK, from the internal region of the protein sequence according to NP_000805.1; NP_068712.1.

Rabbit Anti-GABAA Receptor, b3 (Ser408/409) Antibody (Phospho-Specific)

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser408/409 conjugated to KLH
Modifications Phospho-specific

Rabbit Polyclonal anti-GABRB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: DIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSF

Rabbit Polyclonal Anti-GABRB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK

Rabbit Polyclonal Anti-GABRB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRB3 antibody: synthetic peptide directed towards the middle region of human GABRB3. Synthetic peptide located within the following region: ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA

GABRB3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-460 of human GABRB3 (NP_000805.1).
Modifications Unmodified