Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-Connexin 26 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26

Rabbit Polyclonal Anti-GJB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen GJB2 antibody was raised against a 16 amino acid peptide near the center of human GJB2.

GJB2 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide mapping at the middle region of rat Connexin 26

Rabbit Polyclonal Anti-Connexin-26

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HEKKRKFMKGEIK, corresponding to amino acid residues 100-112 of rat Connexin-26. Intracellular, cytoplasmic loop.

Rabbit Polyclonal Anti-GJB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2. Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW

Goat Polyclonal Antibody against GJB2

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence YLLIRYCSGKSKKP, from the C Terminus of the protein sequence according to NP_003995.2.

Anti-GJB2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 212-227 amino acids of Human gap junction protein, beta 2, 26kDa

GJB2 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse GJB2