USD 480.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) mouse monoclonal antibody, clone 2B8-2A5
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) mouse monoclonal antibody, clone 2B8-2A5
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 440.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) mouse monoclonal antibody, clone R4.5, Purified
Applications | IHC, WB |
Reactivities | Bovine, Guinea Pig, Human, Mouse, Rat |
USD 440.00
2 Weeks
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Synthetic peptide |
Rabbit Polyclonal Anti-GNAI1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAI1 antibody: synthetic peptide directed towards the middle region of human GNAI1. Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
USD 360.00
5 Days
G protein alpha inhibitor 1 (GNAI1) (+ GNAI2) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | Peptide corresponding to amino acids 345 - 354 of Gialpha1 and 346-355 of Gialpha2. |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GNAI1 mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GNAI1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNAI1 |
GNAI1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNAI1 |
GNAI1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-354 of human GNAI1 (NP_002060.4). |
Modifications | Unmodified |
USD 379.00
In Stock
GNAI1 mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GNAI1 mouse monoclonal antibody,clone OTI2D1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GNAI1 mouse monoclonal antibody,clone OTI2D1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 159.00
2 Days
GNAI1 mouse monoclonal antibody,clone OTI2D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |