Primary Antibodies

View as table Download

GNLY rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GNLY

Rabbit Polyclonal Anti-GNLY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNLY antibody: synthetic peptide directed towards the n terminal of human GNLY. Synthetic peptide located within the following region: TRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPSTG

GNLY mouse monoclonal antibody, clone B-L38, FITC

Applications FC
Reactivities Human
Conjugation FITC

GNLY mouse monoclonal antibody, clone B-R32, Azide Free

Reactivities Human

GNLY mouse monoclonal antibody, clone B-L38, Azide Free

Reactivities Human

GNLY mouse monoclonal antibody, clone B-L38, Purified

Applications FC
Reactivities Human

GNLY (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 13-43 amino acids from the N-terminal region of Human GNLY

GNLY rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human GNLY